SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116052961|ref|YP_793279.1| from Pseudomonas aeruginosa UCBPP-PA14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116052961|ref|YP_793279.1|
Domain Number 1 Region: 11-372
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.67e-108
Family FMN-linked oxidoreductases 0.0000000101
Further Details:      
 
Domain Number 2 Region: 343-527
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.65e-40
Family N-terminal domain of adrenodoxin reductase-like 0.0000224
Further Details:      
 
Domain Number 3 Region: 479-636
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000902
Family C-terminal domain of adrenodoxin reductase-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116052961|ref|YP_793279.1|
Sequence length 681
Comment 2,4-dienoyl-CoA reductase [Pseudomonas aeruginosa UCBPP-PA14]
Sequence
MRNPYPPLAAAPYPHLLAPLDLGFTRLRNRVVMGSMHTGLEDRLWDFGKLAAYYRERARG
GAGLIVTGGFAPCREGWLLPFGSSLTSALEVPAHRRLTQAVHAEGGKILLQILHAGRYGY
HPMAVSASPLKSPISWFTPRELSERGIRKTIRAFVRCARLAKAAAYDGVEVMGSEGYLLN
QFLCPRTNRRDDQWGGPLENRMRLALEIVRGIRRIVGERFILCYRLSLLDLVEGGNTWDE
VRRIALALEEAGITLLNTGIGWHESRVPTIVTSVPRAAFAEVSARLRHELKVPVIASNRI
NTPEVAESLLAAGKADLVSMARPLLADPQFVAKAGAGRAEEINTCIACNQACLDHAFANR
RATCLVNPRAAFETELRYRKARTQKRIAVIGAGPAGLSAACVAAERGHRVSLFEASGEIG
GQFNLAKRIPGKEEFRETLRYFRVRLERLGVDLRLGHRVRQGELDGQFDDVVVATGIQPR
RPRIDGIGGPTVLSYVDVLRGAPVGARVAIVGAGGIGFDVAAFLVAAPSDGQPRALGEWL
AEWGVDLDNSQPGGLREPAPTQPARQVWLLQRKPGAPGAQLGKTSGWVHRAHLRHNAVRM
LGGVEYLKIDERGLLIRVDGEERWLEVENVVICAGQEPLRELQISQAAESLRFHLIGGAR
VAGELDAKRAIREGAMLAARL
Download sequence
Identical sequences A0A0H2ZI08 A0A157U3W3
WP_004365411.1.10248 WP_004365411.1.10575 WP_004365411.1.10895 WP_004365411.1.11318 WP_004365411.1.12150 WP_004365411.1.13085 WP_004365411.1.13718 WP_004365411.1.13743 WP_004365411.1.16751 WP_004365411.1.16811 WP_004365411.1.17108 WP_004365411.1.17177 WP_004365411.1.17223 WP_004365411.1.18156 WP_004365411.1.18440 WP_004365411.1.18508 WP_004365411.1.19089 WP_004365411.1.19199 WP_004365411.1.19351 WP_004365411.1.19640 WP_004365411.1.2012 WP_004365411.1.20825 WP_004365411.1.20880 WP_004365411.1.20890 WP_004365411.1.23264 WP_004365411.1.2530 WP_004365411.1.28757 WP_004365411.1.30563 WP_004365411.1.30615 WP_004365411.1.31457 WP_004365411.1.31655 WP_004365411.1.32359 WP_004365411.1.33047 WP_004365411.1.33294 WP_004365411.1.33438 WP_004365411.1.33833 WP_004365411.1.34556 WP_004365411.1.35442 WP_004365411.1.35968 WP_004365411.1.36064 WP_004365411.1.373 WP_004365411.1.37571 WP_004365411.1.38023 WP_004365411.1.38816 WP_004365411.1.39765 WP_004365411.1.40442 WP_004365411.1.40984 WP_004365411.1.41110 WP_004365411.1.41429 WP_004365411.1.42316 WP_004365411.1.42499 WP_004365411.1.43286 WP_004365411.1.43729 WP_004365411.1.43756 WP_004365411.1.43998 WP_004365411.1.44725 WP_004365411.1.45604 WP_004365411.1.45700 WP_004365411.1.48472 WP_004365411.1.49108 WP_004365411.1.49806 WP_004365411.1.52500 WP_004365411.1.52850 WP_004365411.1.53072 WP_004365411.1.55387 WP_004365411.1.55813 WP_004365411.1.56626 WP_004365411.1.57020 WP_004365411.1.57369 WP_004365411.1.58200 WP_004365411.1.58360 WP_004365411.1.58510 WP_004365411.1.58800 WP_004365411.1.58944 WP_004365411.1.60084 WP_004365411.1.60472 WP_004365411.1.60509 WP_004365411.1.62703 WP_004365411.1.63739 WP_004365411.1.64544 WP_004365411.1.6461 WP_004365411.1.64886 WP_004365411.1.65312 WP_004365411.1.65632 WP_004365411.1.66155 WP_004365411.1.68172 WP_004365411.1.68499 WP_004365411.1.68979 WP_004365411.1.70537 WP_004365411.1.70583 WP_004365411.1.71249 WP_004365411.1.7163 WP_004365411.1.72920 WP_004365411.1.74281 WP_004365411.1.74326 WP_004365411.1.74685 WP_004365411.1.75603 WP_004365411.1.76077 WP_004365411.1.76141 WP_004365411.1.76775 WP_004365411.1.78118 WP_004365411.1.79754 WP_004365411.1.8038 WP_004365411.1.80683 WP_004365411.1.80785 WP_004365411.1.81470 WP_004365411.1.81856 WP_004365411.1.81874 WP_004365411.1.81927 WP_004365411.1.83440 WP_004365411.1.83503 WP_004365411.1.83540 WP_004365411.1.84558 WP_004365411.1.85150 WP_004365411.1.85638 WP_004365411.1.85920 WP_004365411.1.86665 WP_004365411.1.86796 WP_004365411.1.86970 WP_004365411.1.8785 WP_004365411.1.87888 WP_004365411.1.88540 WP_004365411.1.89480 WP_004365411.1.91392 WP_004365411.1.92630 WP_004365411.1.93264 WP_004365411.1.93568 WP_004365411.1.93889 WP_004365411.1.94078 WP_004365411.1.95782 WP_004365411.1.96058 WP_004365411.1.961 WP_004365411.1.985 WP_004365411.1.98873 WP_004365411.1.99065 WP_004365411.1.99378 WP_004365411.1.99772 gi|116052961|ref|YP_793279.1| 208963.PA14_63640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]