SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119719134|ref|YP_919629.1| from Thermofilum pendens Hrk 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119719134|ref|YP_919629.1|
Domain Number 1 Region: 5-159
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, N-terminal domain 2.62e-52
Family Bacterial fluorinating enzyme, N-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 165-262
Classification Level Classification E-value
Superfamily Bacterial fluorinating enzyme, C-terminal domain 6.93e-22
Family Bacterial fluorinating enzyme, C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119719134|ref|YP_919629.1|
Sequence length 263
Comment hypothetical protein Tpen_0216 [Thermofilum pendens Hrk 5]
Sequence
MDSARIIAFLSDFGTRDYYVGAVKAVVHSLCPQSTVVDVTHEVEPWSVEDACYILRCCYD
DFPSRTVFLVVVDPGVGTSRKAIILEHKGYLFVGPDNGLLPCAVGNKEFKAWEILRVPGA
RRKTSHTFHGRDVFAPVAAFLSCGGRPEEIGREYADPVLMDIEETILEEGWVKARVIHVD
RFGNVALGVRPEKFFREYGPTRIRVAFDDHEVDVPFVRTFGDAPRGSLVALVNSCGYLEL
AVNMGNASEVLGLKPGRIVKIKF
Download sequence
Identical sequences A1RWP6
gi|119719134|ref|YP_919629.1| 368408.Tpen_0216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]