SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119719418|ref|YP_919913.1| from Thermofilum pendens Hrk 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119719418|ref|YP_919913.1|
Domain Number 1 Region: 8-278
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.57e-41
Family ROO N-terminal domain-like 0.00000321
Further Details:      
 
Domain Number 2 Region: 253-387
Classification Level Classification E-value
Superfamily Flavoproteins 5.43e-22
Family Flavodoxin-related 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119719418|ref|YP_919913.1|
Sequence length 401
Comment beta-lactamase domain-containing protein [Thermofilum pendens Hrk 5]
Sequence
MPRVFVDKVVDDLYVLRVDDDRTRFFEALWEIEEGITYNAYLLLTGEGAVVFDGWKKWFS
ELFLEKIREIVDYGDIRYVVVHHAEPDHSGSVPDVLRVSEKAVALGHPIAGRMLSSFYGV
TRFRPVKDGEELKVGERSIHFVYTPWLHWPETIMSYLRDDGVLLSCDAFGSYSVPALYDE
SVENFEKLAWFIKKYYVTVIGHYSPHVLKALEKLGSLGVKPRIIAPSHGTIFRRNAERIL
DEYRRIALGEPVKGKAVVVYVSMYGFVERLVSLAIEELSQRGFETRVYAFTDTSRPRISD
ILGELADAELLVLGGATYEAGVQPVLDYVVRLIAEKLEYRSDKLAVLLLSSYGWAGTAGK
LVAEALKGHGFQRVSSVEVQGYAPENVKENLKKALDSLLSL
Download sequence
Identical sequences A1RXI0
gi|119719418|ref|YP_919913.1| 368408.Tpen_0503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]