SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119719840|ref|YP_920335.1| from Thermofilum pendens Hrk 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119719840|ref|YP_920335.1|
Domain Number 1 Region: 7-45,184-375
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.94e-16
Family Bacterial dinuclear zinc exopeptidases 0.022
Further Details:      
 
Domain Number 2 Region: 71-194
Classification Level Classification E-value
Superfamily PA domain 0.0000000916
Family PA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119719840|ref|YP_920335.1|
Sequence length 539
Comment aminopeptidase [Thermofilum pendens Hrk 5]
Sequence
MKIREIAYELTSALPRGDVVAGSREEHESLEAVAGYLDGLSAQVHYFPCSTWVEKGVELS
GGGLRVKAVAMPGSPSGELYLEPVYLGERVLPEEWEGVDLEGKIAVVKMYGKVDEAAWQY
VQAVARGAEAVVFVDPFPDRRRRIVVTATPDYRFGPGTPPPVPAVAVSLEDGLRLARVSG
RGEKLYLRVETAFDHSARTGVVVAGNAGGPLFTAHVDKWLSGFTDNVLGVALVVALSRAF
GESAGYAVFGAEEYGAPGHSPWYWIWGSRSYADFLERRGELDSLGVVVNLDVLGGAGITV
SASGPDFQGGLGKALGEGYRYTSDQVIFDSFSFTMKGVAAATLHTFQDVLPVYHTDLDEP
QRVDWEKVLEAYTLAERAGEAFLREEWGLLEYSLLKRVALEKLEKVYFLEEARRVAGLLE
GVNIRDEHDARHLRRLFTRPLHRGRYGEVFSEVEAVYPYILDAVEDLLVLKRAVEEGSRS
VPARIFFTRIVPGWEEVLVDLEPPGKRHGGVLKEYYESFLRAVRRSLESMEEALLELKR
Download sequence
Identical sequences A1RYQ2
gi|119719840|ref|YP_920335.1| 368408.Tpen_0931 WP_011752597.1.94153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]