SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119719955|ref|YP_920450.1| from Thermofilum pendens Hrk 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119719955|ref|YP_920450.1|
Domain Number 1 Region: 141-263
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000000000136
Family MJ1460-like 0.022
Further Details:      
 
Weak hits

Sequence:  gi|119719955|ref|YP_920450.1|
Domain Number - Region: 27-100
Classification Level Classification E-value
Superfamily ACT-like 0.000342
Family Phenylalanine metabolism regulatory domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119719955|ref|YP_920450.1|
Sequence length 271
Comment 4-vinyl reductase, 4VR [Thermofilum pendens Hrk 5]
Sequence
MEKYKPYRVGRTVYAVGKTPVFFNISLSPAALEEVGVLERILEVFRRANVSILTFKVSGS
RPGISEPGRVVLAADLTGRMGELRDLVSSLSSLPHVLSVETAPPLFDGFAMDLWSFPLLF
DEKRVVFFDEEFLRGFILGGWRKLGDGYGGILFYSSFQAARRVFDEYIAPKSSKLEDRLL
LVEEILRVFGLGVFKVSSYSEREVVVKVYDGTEAKALKGTEVPAEFITKGMLAGLVSGLW
GAPYGEVWVEEKKCVLRGDEYCETHLKRRPS
Download sequence
Identical sequences A1RZ17
WP_011752712.1.94153 gi|119719955|ref|YP_920450.1| 368408.Tpen_1047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]