SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119720176|ref|YP_920671.1| from Thermofilum pendens Hrk 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119720176|ref|YP_920671.1|
Domain Number 1 Region: 31-111
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000275
Family Carboxypeptidase regulatory domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|119720176|ref|YP_920671.1|
Domain Number - Region: 189-262
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000484
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.017
Further Details:      
 
Domain Number - Region: 145-196
Classification Level Classification E-value
Superfamily E set domains 0.0215
Family Filamin repeat (rod domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119720176|ref|YP_920671.1|
Sequence length 418
Comment hypothetical protein Tpen_1270 [Thermofilum pendens Hrk 5]
Sequence
MLRRRVYALVLLALAVAYAATRNASAQVPVTVWGYVKMPDGSPAAGASVTVSAGGASAST
VTDSTGKYKVDLTVSSTPVTVTVTASLGGYAGSASASGEGVVRVDVVLQPPPPPPKKPTS
VYVSVDRPEYGVGDAALVQGRLSPAMQAAVKVVVVAPNGSRYEVSVSTGSDGSFTVRIPL
TSRGAWSIYAAFPGSDEYSPSTSQVVTVVAKEKTFLSVSARSPAPGIVQVSGSLAPAPSG
AVVEVYVSIDNGSTWARLLNAPVGGDGSFSANLSTAVYGRILVKAVFRGTFDYAQSETAP
VAVEVSSPRELLLTQENERLKAREKALNETLERLSAEVGELRRLSDELKSSLSSCNATVE
ARERALENLERELALLRGELEKTRLLAYAAVPAAAALGALAGFALGRRKRGKREAPSA
Download sequence
Identical sequences A1RZN8
gi|119720176|ref|YP_920671.1| 368408.Tpen_1270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]