SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119720184|ref|YP_920679.1| from Thermofilum pendens Hrk 5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|119720184|ref|YP_920679.1|
Domain Number - Region: 114-145,272-318
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00204
Family Polyphosphate kinase C-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119720184|ref|YP_920679.1|
Sequence length 327
Comment hypothetical protein Tpen_1278 [Thermofilum pendens Hrk 5]
Sequence
MELRFVKTLLDAGKTYFESKGVTSFDLEKFAEMLRLASSLRKVDAKTIADALGLHPSDAS
GYLRLGWHSGLLSYSGKAYYATRLARDVAGACSEPGSRGCVEAVRRVMLSWYPLRVFLSY
LCSRRSFNAMDAVRELGGEMRYWNGVMMRLGLPVSPAGGGEAPEKPFNSYVVSALFERMV
DQLYVGCEHLREPAEYWYVRGREDEPVVAVAVAHVVYTYREPVLVTPRVDDEGLGLVVRA
LREAGPGRSATLVTVKGQGVARYPGLDVEFTEKPLHANIYASEGEVLLSSANLTGDSLYR
SVEFGVVVKSSPSLLAVVDDLLPGVLL
Download sequence
Identical sequences A1RZP6
gi|119720184|ref|YP_920679.1| WP_011752941.1.94153 368408.Tpen_1278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]