SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119720359|ref|YP_920854.1| from Thermofilum pendens Hrk 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119720359|ref|YP_920854.1|
Domain Number 1 Region: 38-449
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.11e-91
Family Amylase, catalytic domain 0.00000000619
Further Details:      
 
Domain Number 2 Region: 452-535
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.72e-25
Family alpha-Amylases, C-terminal beta-sheet domain 0.00016
Further Details:      
 
Domain Number 3 Region: 631-735
Classification Level Classification E-value
Superfamily Starch-binding domain-like 1.4e-20
Family Starch-binding domain 0.00019
Further Details:      
 
Domain Number 4 Region: 541-629
Classification Level Classification E-value
Superfamily E set domains 0.000000000000267
Family E-set domains of sugar-utilizing enzymes 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119720359|ref|YP_920854.1|
Sequence length 739
Comment alpha amylase, catalytic region [Thermofilum pendens Hrk 5]
Sequence
MRSRKIAAILAILLLLGVLIGTSQATAGPSPSYPTGDPQTWVIYQIVIDRFYDGNTSNNN
PAKSPGLYDPTKTNWRLYWGGDIDGIIAKLPYLYELGVTAIWISPVFDNIDVAINTSSGL
QAGYHGYWPKDFKVIEEHFGSWSTFYKLIQEARKYNITVIIDFVVNHSNPSDAGEYGALY
DNGTFVTDYPTDAKYATVDPITRSLSNIYNHNGGITNWNDRWEVRYKNLFNLADFNQLNP
WVDRYLKESTALYLKAGIGGIRLDAVKHVEPGWLKTYADYVYAIKNVFMFGEWYQSFNDE
MYWDMVKFANDSGISVINIPLQQVLVDVFAYDTKTMYDLDNAVKKYTSNFMWQNKLVNFI
DSHDVPRFLSLSKSITRFHQVLAFVMTAPGIPVIYYGDEQYLHYDATNEFGQVGGDPYNR
PMMTSWDTTTTAFKLIKALAQLRRANTALAYGLVTTRYVSSDVYIFERKFFGNVVLVAIN
RNLNSPVAVSNVYTSLPDGVYSDYLGGLINGTSIKVVGGKFSVTLPPGSVSVWQYKAVPS
GPWVGAIDPTMGRAGNVVVISGEGFGSQPGQVLITNGQSTWSATVTYWSDKSIEFIVPSG
VTTPLNDNHVTVIVKRADGATSNGIAFQYLSGRQIPVIFEVQNTKGTTLETVPGEFLWLT
GSVPELSNWSPATTRAVGPMLCPAWPNWFVVASVPANTYIEFKFLKAPLGGTGVWEPGSN
HAYTTPSDGIGRVSVTANG
Download sequence
Identical sequences A1S071
WP_011753116.1.94153 gi|119720359|ref|YP_920854.1| 368408.Tpen_1454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]