SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119720363|ref|YP_920858.1| from Thermofilum pendens Hrk 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119720363|ref|YP_920858.1|
Domain Number 1 Region: 212-578
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.35e-91
Family Amylase, catalytic domain 0.000000315
Further Details:      
 
Domain Number 2 Region: 116-216
Classification Level Classification E-value
Superfamily E set domains 1.96e-16
Family E-set domains of sugar-utilizing enzymes 0.003
Further Details:      
 
Domain Number 3 Region: 24-85
Classification Level Classification E-value
Superfamily E set domains 0.0000000077
Family AMPK-beta glycogen binding domain-like 0.013
Further Details:      
 
Domain Number 4 Region: 578-619
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000103
Family alpha-Amylases, C-terminal beta-sheet domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119720363|ref|YP_920858.1|
Sequence length 644
Comment alpha amylase, catalytic region [Thermofilum pendens Hrk 5]
Sequence
MYRVLGFRDDVYLGRVVKAEFSAPREGEYAYLLGNFNAFNEGSFRMRGAGDRWVVEVELP
EGVWYYLFSLGGRRAVDPENPETTVYSRRAYKFEERVSVAKLLGFDPASCNGFCEEALYH
YPSLTYVYPFGGVLFVRLRALRGSLQKAFLVVDGRRLEMRLKARDEVFDYYEASLEAGGE
VSYYFEVLGGGRLHRYGEFSVDVKSLESLIRVPEWVYGSVFYQIMPDRFAEGGLEEIAER
LNHVSGLGANALYLTPIFESTTYHGYDVVDYYRVAGRLGGDEAFGRLLAELKKRGMRVVL
DGVFHHTSFFHPYFQDLVEKGEESRYKGFYRVLGFPVVPREFLEALRSGAPRHELKKYPR
RYESFFDVWLMPRLNHDNPEVRSFITGVGRYWVSRGVDGWRLDVAHGVPPELWREFRETL
PGDVYLFGEVMDDARIWLFDKFHGAMNYLLYDAVLRFFAYREITAEEFLNRLELLSVYYG
PGEYAMYNFLDNHDVDRLLSLVGDRDKYLCALVFLFTYKGVPSIYYGDEVGLENTDSPFM
ERSRAPMRWDESTWDKAILEATRALASLRRRSAALQRGAFEPVRFEGGLLVYRRRLGDES
ILVAINYSESEAVLEEPAQSVLFRSGSVKEKLLGPFSSVVAGDR
Download sequence
Identical sequences A1S075
WP_011753120.1.94153 368408.Tpen_1458 gi|119720363|ref|YP_920858.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]