SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119720632|ref|YP_921127.1| from Thermofilum pendens Hrk 5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|119720632|ref|YP_921127.1|
Domain Number - Region: 33-260
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 0.000306
Family Cellulases catalytic domain 0.078
Further Details:      
 
Domain Number - Region: 472-546
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00179
Family Starch-binding domain 0.091
Further Details:      
 
Domain Number - Region: 553-621
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00844
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number - Region: 387-469
Classification Level Classification E-value
Superfamily E set domains 0.035
Family E-set domains of sugar-utilizing enzymes 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119720632|ref|YP_921127.1|
Sequence length 639
Comment hypothetical protein Tpen_1729 [Thermofilum pendens Hrk 5]
Sequence
MKKAALAVLVLLVAATLVPPQRQASVEAKPPVDWLELARAAWGYFSPGFGLSQRGINYAT
PSWHYVTDWDVGSYLSAIVDAAWLGLISRDEAISRAEKVLAFLSTRPLHPSGVPYSAYSS
DTGMPAENAGPSNPSDAGRLLIALYRLKKSFPELAPTVDYVVERNGFSAFAGSVPDSGFY
SYYYAYGFHLWGFNTPQVMKALSMLGRLPYTRTVDAYGVRLPYVEVTMEPILLTIFELDP
PPEFYEWAYKVYKAQENRYLATGKPTAFTEGQVNAPPYYIYEWIVDIYTGETWTVWSGSL
GKLSMTPVVYAKAALGMHAIWNTNYTAFLAEYVMKAKTPNCFYEGVDENGNVVYAITDKT
NAMIVSAARYALQRASKPSVTAGAVPALYPGENATITLNVTHQLPLPITLSAEAPPGITA
EVEPSTGKANLTARLKVSARQGLAPGNYTVTVKVSTIAHNETLTLTVTVKPPGYTLRVRV
VDACGDPVPGATLLLNGLKAGETDAKGEAEVKHVEGEATLTAIYAGLEVAGPLKISVNSD
TNATLKANLRKIAVAFTTPDGKPATGILVVALLGRTTLSTAKTNSTGHALLPRIPPANIT
LQAYTPDGKLLLGEWTVNAAQGEGVVDPEIPPTTRHLEA
Download sequence
Identical sequences A1S0Z4
368408.Tpen_1729 WP_011753389.1.94153 gi|119720632|ref|YP_921127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]