SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148359583|ref|YP_001250790.1| from Legionella pneumophila str. Corby

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148359583|ref|YP_001250790.1|
Domain Number 1 Region: 26-188
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000361
Family FCH domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148359583|ref|YP_001250790.1|
Sequence length 211
Comment stress-induced protein [Legionella pneumophila str. Corby]
Sequence
MLINIGTINALLDLSGKLSASHHLANDMTVSQVLSWPGVVEANPLDMEELSQIALELFQK
SIDKLCEVRAGEGRSLKAYVEDRLQALRQEVMKSKSIMVSMSAKTKDKLLTRLHELQMDV
TEARVEQEIALLLAKLDVSEELDRLETHIAEVNRTLNAEKVTGRRLDFLMQELNREANTL
SSKSDSAELTLCAVEMKVLIEQMREQIQNFE
Download sequence
Identical sequences 400673.LPC_1495 gi|148359583|ref|YP_001250790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]