SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|114570554|ref|YP_757234.1| from Maricaulis maris MCS10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114570554|ref|YP_757234.1|
Domain Number 1 Region: 14-105
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000255
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|114570554|ref|YP_757234.1|
Sequence length 384
Comment hypothetical protein Mmar10_2004 [Maricaulis maris MCS10]
Sequence
MRGMRDESPARAELVVREEGERTILEPHGDWVIDTIGRHDNAIRAVEASADPCSIVVDVS
HLGRVDTAGAYLLGRATRKCPTPDADFHFVGQHRTVRRLIEEVRMRTQVCGPDEVPTFGF
IKALARLGAGIEVAYQEAVDTFAFFGKTLTTGLSCFIQPWRFRLTPTVWAMEEVGVNALP
IVATLTFFIGAVVAYMGATLLQSFGASVFTVDLVGLAVLREFGVLITAIMLAARSDSAFT
ASIGAMKMQQEIDAMRVLGLDPYEALVLPRVVACVLMAPLLTFGAMVAGIFGGMLVAWTA
QDISPALFFTRLHSEIDISHFWVGMSKAPVFGMVVAIIGCRQGMQVQGDVESLGRRVTAS
VVQSIFAIIVLEALFAMMYLELEI
Download sequence
Identical sequences Q0AN41
394221.Mmar10_2004 gi|114570554|ref|YP_757234.1| WP_011643941.1.83773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]