SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150020315|ref|YP_001305669.1| from Thermosipho melanesiensis BI429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150020315|ref|YP_001305669.1|
Domain Number 1 Region: 260-294,327-583
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.57e-50
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000479
Further Details:      
 
Domain Number 2 Region: 1-169
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.56e-31
Family H-NOX domain 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150020315|ref|YP_001305669.1|
Sequence length 597
Comment methyl-accepting chemotaxis sensory transducer [Thermosipho melanesiensis BI429]
Sequence
MKSFVMNIWINTWKKLYGEKVVNELIESFNLNTEVLLNPINDVEDNFVVKFSQELSKKVG
KTYEQLWEETGFENIFTFRSYYPGYFKKDGILSFLSVMDMVHRALTRRIKGAKPPRIIYT
YIDEKTARIRYESKRDFRSYFIGLTKGASKLFDDPVELEILNQGSNSSGAFIEIKVKATK
PYGKLIRLKAFKLVSFGLLKNILNNNLIFFPLILFVISLLSSSFTPPVVSSIIIAISSFV
LSIPVVFDLKKGFKSLKFDDLSSVTYITGERNFEEISQKLNKANEKFKEMFISFQGDTEE
LLNFSEKTMNSIDIVQEQIDTMKDLSTQVADTAIQISNDAERISETVSSNVETISQTINQ
QNEIIKSLNEAVDNIVSAAQSVENAYLNIGKVSNDFEKIANESENLRNDADEIKKIANTV
MNIAEQTNLLALNAAIEAARSGEAGKGFAVVADEIRKLAEESKLSANRISNFLSRISNGI
KNLNAGIISGYESLKEQTKALSESSEKSKASSNVISGITQQLNSLIDALNSEAAKLDDIT
NSIQNLLAISEESSATAEEISASIQRFLSEIKSVFENVTQTINLLKLIQENLNKVDI
Download sequence
Identical sequences A6LK33
WP_012056645.1.25510 WP_012056645.1.29063 WP_012056645.1.34498 WP_012056645.1.43064 WP_012056645.1.53857 WP_012056645.1.82961 WP_012056645.1.85686 gi|150020315|ref|YP_001305669.1| 391009.Tmel_0416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]