SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150021536|ref|YP_001306890.1| from Thermosipho melanesiensis BI429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150021536|ref|YP_001306890.1|
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily AF1862-like 3.01e-26
Family Cas Cmr5-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150021536|ref|YP_001306890.1|
Sequence length 123
Comment CRISPR-associated Cmr5 family protein [Thermosipho melanesiensis BI429]
Sequence
MERENKTKLIAKQLIVEKTSRNDLELKSYKSLIKGLGAMIIQNGLYGTLVFLKAKGENKT
SKKHYHYVFEDIKHFLNEKGLFSNNDILEYLERTENLSEIQERVLELVNWYRRYVEIFIS
DED
Download sequence
Identical sequences A6LNK4
gi|150021536|ref|YP_001306890.1| WP_012057864.1.25510 WP_012057864.1.29063 WP_012057864.1.34498 WP_012057864.1.43064 WP_012057864.1.53857 WP_012057864.1.82961 WP_012057864.1.85686 391009.Tmel_1661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]