SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549688021|ref|YP_008619753.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549688021|ref|YP_008619753.1|
Domain Number 1 Region: 4-245
Classification Level Classification E-value
Superfamily CutC-like 2.22e-75
Family CutC-like 0.00000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|549688021|ref|YP_008619753.1|
Sequence length 247
Comment putative Cytoplasmic copper homeostasis protein cutC [Vibrio nigripulchritudo]
Sequence
MTYQLEVCIDNLESLQNALEGGATRIELCSSLSLGGLTPSAGLMKQASRLSSVPVYAMIR
PRQGDFLFNEADVECMLDDIEMAKDAGMDGIVIGALTADGQIDMETCEKLVSAADRMGIT
FHRAIDQCRDVEQAIECIIELGCERVLTSGQAKDALSGIDMLRKMRDLAEDKLSIMVGAG
VNAQNVSQILDETGSFEVHLSGKSRRKSHMEFISSAAQMGSEEVDDFAIPVTSIDAIRAV
SEILQSR
Download sequence
Identical sequences U4K1T8
gi|549688021|ref|YP_008619753.1| WP_022549743.1.100974 WP_022549743.1.41471 WP_022549743.1.79392 WP_022549743.1.83433 WP_022549743.1.85604 WP_022549743.1.99411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]