SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549689366|ref|YP_008621098.1| from Vibrio nigripulchritudo VibrioScope

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|549689366|ref|YP_008621098.1|
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily CutC-like 4.32e-51
Family CutC-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549689366|ref|YP_008621098.1|
Sequence length 214
Comment putative Cytoplasmic copper homeostasis protein cutC [Vibrio nigripulchritudo]
Sequence
MIKEICVENFTSIPDAIKNGANRISLKDNYLEQGTTVSNGVMKASIEYAHKNNIPVVVCI
RPRKGNFIYTPQEIEIMQTDIKLAKELGADAIDFGCLNQNNSIDKEATLKILESAEELKT
VFHMAFDSIPRSEHQETIDWLHKQGVTHILSHGSPISEPINIAYLKETIAMAKGKLTIVP
GGGINYSNVETIASELNVSEVHGSHIVKLDNYEF
Download sequence
Identical sequences U4K5P2
gi|549689366|ref|YP_008621098.1| WP_022550830.1.100974 WP_022550830.1.41471 WP_022550830.1.79392 WP_022550830.1.83433 WP_022550830.1.85604 WP_022550830.1.99411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]