SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126174264|ref|YP_001050413.1| from Shewanella baltica OS155

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126174264|ref|YP_001050413.1|
Domain Number 1 Region: 23-254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.83e-51
Family Extended AAA-ATPase domain 0.000000328
Further Details:      
 
Domain Number 2 Region: 260-331
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.26e-25
Family Helicase DNA-binding domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126174264|ref|YP_001050413.1|
Sequence length 334
Comment Holliday junction DNA helicase RuvB [Shewanella baltica OS155]
Sequence
MIEADRLIQPQIQAQDESIDRAMRPKMLDEYTGQDHTRAQLKVFIQAAKNRNEALDHMLI
YGPPGLGKTTLAMIVANEMGVNIKSTSGPVLEKAGDLAALLTNLESGDVLFIDEIHRLSP
VVEEILYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLVGATTRAGALTSPLRARFGIPLR
LEFYNIKDLSTIVTRSAQVMELDIDAEGAFEIARRSRGTPRIANRLLRRVRDYAQVKHDG
AVTKFVAEHALDLLDVDSEGFDYMDRKLLLAIIDKFIGGPVGLDNLAAAIGEERETIEDV
LEPFLIQQGFIQRTPRGRIATARAYQHFELIKPE
Download sequence
Identical sequences A3D481
WP_011846756.1.8014 WP_011846756.1.86146 gi|386341104|ref|YP_006037470.1| gi|126174264|ref|YP_001050413.1| 325240.Sbal_2042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]