SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134287664|ref|YP_001109830.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134287664|ref|YP_001109830.1|
Domain Number 1 Region: 15-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.03e-77
Family Acetamidase/Formamidase-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134287664|ref|YP_001109830.1|
Sequence length 412
Comment formamidase [Burkholderia vietnamiensis G4]
Sequence
MPETLIKVDLDQSAYENEQVHNRWHPDIPMACWVKPGDDFILETYDWTGGFIKNDDSADD
VRDIDLSIVHFLSGPVGVHGAEPGDLLVVDLLDIGAKADSQWGFNGFFSKTNGGGFLTDH
FPSAQKSIWDFHGVYTSSRHIPGVNFAGLIHPGLIGCLPDPTLLETWNARETGLIATAPE
RVPPLANPPFAATAHMGKLAGDARDKAAAQGARTVPPREHGGNCDIKDLSRGSKVFFPVY
VDGAGLSVGDLHFSQGDGEITFCGAIEMAGWVHMRVNLIKGGMAKYGIRNPVFQPSPITP
TYNDYLIFEGISVDEQGGQHYLDVTIAYRQACLNAIEYLKKFGYSGAQAYSLLGCAPVQG
HISGVVDIPNACATLWLPTQIFDFDIRPNADGPIQYIQGGVDLPCSPDLAKA
Download sequence
Identical sequences A0A132DNQ8 A4JUU6
WP_011875586.1.82744 WP_011875586.1.85937 gi|134287664|ref|YP_001109830.1| 269482.Bcep1808_7168 gi|134287664|ref|YP_001109830.1|NC_009227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]