SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134288173|ref|YP_001110336.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134288173|ref|YP_001110336.1|
Domain Number 1 Region: 57-274
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3e-43
Family GpdQ-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134288173|ref|YP_001110336.1|
Sequence length 315
Comment metallophosphoesterase [Burkholderia vietnamiensis G4]
Sequence
MSSDLPSRPSRRSALKCLAFGGAGTLFVLSGGVLTPVELALAASSKDKAAASVVPLFLQI
SDSHIGFNKEANPDVAGTLKQTIDYVNAMPIKPALAIHTGDITHLSKPEEFDLAAQLLSG
LNPITELHTVPGEHDVTDGPQGEYFKRFGKASDNRGYYSFDHNGVHFIGLVNVLHFAPNA
LGSLGEDQLSWLESDLKARSSSTPIVVFAHMPMWTIYAPWGWGTGDAGQAMSYLKRFGSV
TVLNGHIHQIVSKVEGNVTFHTARSTAFPIPTAGNGPGPVPLTVASDQLPRMLGVTSIKI
SRHPLAATVSDTTLA
Download sequence
Identical sequences A0A228I876 A4JEF1
gi|134288072|ref|YP_001110236.1|NC_009229 gi|134288173|ref|YP_001110336.1|NC_009230 269482.Bcep1808_1648 269482.Bcep1808_6099 269482.Bcep1808_6642 269482.Bcep1808_7472 gi|134288072|ref|YP_001110236.1| gi|134288173|ref|YP_001110336.1| gi|134291504|ref|YP_001115273.1| gi|134295754|ref|YP_001119489.1| WP_011875862.1.49553 WP_011875862.1.63689 WP_011875862.1.92367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]