SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134290927|ref|YP_001114696.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134290927|ref|YP_001114696.1|
Domain Number 1 Region: 1-305
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.42e-47
Family DNA double-strand break repair nuclease 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134290927|ref|YP_001114696.1|
Sequence length 416
Comment metallophosphoesterase [Burkholderia vietnamiensis G4]
Sequence
MKFIHAADIHLDSPLHGLSAYPDAPAAQLRNASREALRQLVDRAIEEEVAFLVIAGDLYD
GDWKDHNTGIFFGQQMGRLRKEGIRAFVLGGNHDAESEMTKKLTLPDNVTVFGHRKPETF
RLPEFDVALHGQSFKDKAVVDNLAIGYPDPVPGQYNIGVLHTALEGYAAHANYAPCTLAE
LHAKGYDYWALGHVHEFQQWSGPSTIVFPGNLQGRHIRETGRRGAVLVTVEQGRTQVERL
YLDVLRWEAVSVDASECLTVADLSKRIGQSLDALLSVDAHVPRAVRVTVTGRTPAHGLFF
GRAPQLRAEVLNQIGIVGNDRLWLEKVRLATSAPEQQKGDREQLEALEDLKQILADAAHD
PDFLALLERDLKPFVGKVRSDVKEEVPLLTMARAGELTALVEQVGPALLARLATGE
Download sequence
Identical sequences A4JQ88
269482.Bcep1808_5497 gi|134290927|ref|YP_001114696.1| WP_011879655.1.11466 WP_011879655.1.20738 WP_011879655.1.23278 WP_011879655.1.29019 WP_011879655.1.58403 WP_011879655.1.59706 WP_011879655.1.66494 WP_011879655.1.74552 WP_011879655.1.81796 WP_011879655.1.82398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]