SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134292220|ref|YP_001115956.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134292220|ref|YP_001115956.1|
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.85e-56
Family YfcE-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134292220|ref|YP_001115956.1|
Sequence length 244
Comment metallophosphoesterase [Burkholderia vietnamiensis G4]
Sequence
MKIAALSDIHGNLAALDAVLDDVRRRGADVIVNLGDIVSGALHPAETADRLIALDLPTIR
GNHERQLLERTRDAMGLSDRWAHDTLHERHRAWLAALPERATLGDDVLLVHGTPASDLDY
FLETVTRDGCRAATPDEIAQRAEDEPASLILCGHTHVPRVARLADGRTIVNPGSVGLPAY
RDDFPYPHRIETGSPHARYAIVSRTPAGWHAELHTVEYDWQTAADTAAARGRDEWAVALR
TGRC
Download sequence
Identical sequences A4JJN8
gi|134292220|ref|YP_001115956.1| 269482.Bcep1808_3503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]