SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134292256|ref|YP_001115992.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|134292256|ref|YP_001115992.1|
Domain Number - Region: 135-180,218-263
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.00835
Family GpdQ-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134292256|ref|YP_001115992.1|
Sequence length 268
Comment hypothetical protein Bcep1808_3540 [Burkholderia vietnamiensis G4]
Sequence
MPAKHAAGTRDATSQTNRGMSVNIADLQPAADLQDIAARVDAIDWSTVEAELDRYGCAHV
SSLLSRGECDALRALYPHDALYRSRVLMARHGFGCGEYKYFAYPLPAVVDALRATIYPHL
APIANRWNDALRIDVRYPRDHAAFLDRCHDAGQTRPTPLILQYGADDYNCLHQDLYGEHV
FPLQVAILLSAPGRDFTGGEFVLTEQRPRMQSRAEVVPLMQGDAVVFAVHGRPVQGTRGI
YRVNLRHGVSRIRSGHRHTVGIIFHDAS
Download sequence
Identical sequences A4JJS4
269482.Bcep1808_3540 gi|134292256|ref|YP_001115992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]