SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134292433|ref|YP_001116169.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134292433|ref|YP_001116169.1|
Domain Number 1 Region: 5-115
Classification Level Classification E-value
Superfamily DOPA-like 5.75e-43
Family DOPA dioxygenase-like 0.00000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134292433|ref|YP_001116169.1|
Sequence length 117
Comment aromatic ring-cleaving dioxygenase-like protein [Burkholderia vietnamiensis G4]
Sequence
MAIIDPAAIVSWHAHVYFDAASRDAAWALRAVIDERFGASVELGRFHERLVGPHPAWSYQ
IAFGAARFDEIVPWLVLNHGKLDILLHPNTDDELRDHRDSAVWIGNSHSLNLEALAG
Download sequence
Identical sequences A0A132E0Z5 A4JKA1
gi|134292433|ref|YP_001116169.1| WP_011881064.1.242 WP_011881064.1.29019 WP_011881064.1.56091 WP_011881064.1.60365 WP_011881064.1.61106 WP_011881064.1.82744 WP_011881064.1.86522 269482.Bcep1808_3719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]