SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134292931|ref|YP_001116667.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134292931|ref|YP_001116667.1|
Domain Number 1 Region: 10-216
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.12e-36
Family Protein serine/threonine phosphatase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134292931|ref|YP_001116667.1|
Sequence length 241
Comment metallophosphoesterase [Burkholderia vietnamiensis G4]
Sequence
MTSSLCRHPANTTGRDFVVGDLHGCVDVLRALLYDVGFDAARDRLFPVGDLVDRGPASET
ALELLDRPWCHAVRGNHEEVLSLVARGKLSADAWRGIGGDWGADLPPQLLQAHAARVDAL
PLVRVIGDGPERFNVLHAEFFGSDDELDTGSYSHDVRERLIWGRDLVQGLADPALQAGLS
LTCTGHTPVRDLQRIGAQWFIDTGAFAPSGRLTIVEPHTGRSWSLSQADARARRAADLPL
P
Download sequence
Identical sequences A4JLP9
gi|134292931|ref|YP_001116667.1| WP_011881554.1.29019 WP_011881554.1.34430 WP_011881554.1.42332 WP_011881554.1.68849 WP_011881554.1.95492 269482.Bcep1808_4222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]