SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134293399|ref|YP_001117135.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134293399|ref|YP_001117135.1|
Domain Number 1 Region: 140-466
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 6.33e-29
Family Protein serine/threonine phosphatase 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134293399|ref|YP_001117135.1|
Sequence length 486
Comment metallophosphoesterase [Burkholderia vietnamiensis G4]
Sequence
MPRLLSSALFARCAALAAVALSACSNHIDSPADPASAAINVQAAWVEIGDANQAIARVIT
NYSPASASDPVCPQLSVDGKQSRMTLRAGAATVAQRPTASDPADSKPSSFPVSVCEATLP
ADAQAASVAGRTLPLPKAQPQRVAIIADTGCRMKKADNAWQACNDATVWPFDTIAASVAK
LSPDLVLHVGDYHYRENACPPDIAGCKDSPWGYGWDAWQADLFRPAAPLFAKAPWVVVRG
NHEECARAGQGWYRFLDPRPYAATRTCDDPANDADANYSEPYAVSLGGGTQVIVFDSAKV
GRNPLKTTDAQFRIYQKQFQSVASLASKAGMSTTIFTNHHPILAFAPIAGSTPAPGNLAL
QSVMASLNAQAYYPPGIHVALHGHVHDFQAINFSSGHPATIVSGNGGDNLDVALPDPFPA
GLTPAPGAVIERLSHNNSFGFLIMERRPAPATGWLFHAYSAAGKLLASCSQSGTTLACDK
TGFIAP
Download sequence
Identical sequences A4JN17
269482.Bcep1808_4713 WP_011881999.1.242 WP_011881999.1.24430 WP_011881999.1.58403 gi|134293399|ref|YP_001117135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]