SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134293712|ref|YP_001117448.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134293712|ref|YP_001117448.1|
Domain Number 1 Region: 197-332,361-441,481-507
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.07e-46
Family Purple acid phosphatase-like 0.0018
Further Details:      
 
Domain Number 2 Region: 84-192
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 3.14e-20
Family Purple acid phosphatase, N-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134293712|ref|YP_001117448.1|
Sequence length 602
Comment metallophosphoesterase [Burkholderia vietnamiensis G4]
Sequence
MRGTGFPLVSGRSSGRACARPDGSALRVSSNENPIMSNQDTFTAESNESNASNEPAASVS
RRGFLKLAGVSSLATAASGLGAARAAAATPDGTPEQVHLTWGNDPSSEVAISWASLAPAV
NPRARIVADGEPARTVHGVQRIYTDGLNGETVFTYHARVHGLKPNTRYRYELTADNDSNA
AQPFAATFATAPRGRAPFRFTSYGDLATPNGAWVLSSPQSRFAVQAVEQFQPLFHLLNGD
LCYANLNPAHQPEVWRDFGNNNQSSAANRPWMPCPGNHEIEFNNGPQGLDSYLARYQLPE
NGTRFPGRWYSFRVSSVLFISLDADDVVYQDAAAFVAGPAPLVPAASTGHAPIEPGTSFY
VRGYSNGEQTRWLEHTLRHAAHDDDIDWIVVQMHQDALSSSKTGNGSDKGIREAWLPLFD
RYGVDLVLCGHDHDYERSYPVRGCNHRAGVDASTGEVVETLQPRPVGPADPDRTTFDTSA
GTIHLILGGGGTSAPLDVYGENPATGYAQAKVFTKPNRPVPGTAPNTFVRKPADALEDAI
WSARRDTGTGYGIAVFDHDPGKPGGHTTITMRYYHAPGADQHPSPQYELFETIELRKQRR
EH
Download sequence
Identical sequences A4JNY0
gi|134293712|ref|YP_001117448.1| 269482.Bcep1808_5032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]