SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134293936|ref|YP_001117672.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134293936|ref|YP_001117672.1|
Domain Number 1 Region: 155-381
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.63e-38
Family GpdQ-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134293936|ref|YP_001117672.1|
Sequence length 382
Comment metallophosphoesterase [Burkholderia vietnamiensis G4]
Sequence
MRSFFVRFIAIGVLLHLYVGMRIIPDAFTSPLARTVAALVLASFVVLIPVGMFSRRFDEG
WAATLFGWTGALAMGFFSSLLVLTLLRELVLLGVVAWRQFVHPGAWSDAASATALAVLAA
AVLVSAIGFVGARRTAAVKRVSIPVDELPAALDGLTIVQLSDIHVGPTIKRPFIERIVRV
VNALDADLVVVTGDVVDGSVERLREHTAPLGSMRSRHGSFLVTGNHEYYAGAHAWIDEFR
RIGLTVLLNEHVLIERDGARAVLAGVTDFTAGGFDPAHRSDPEQALAGAPPDVATRILLA
HQPRSAQAASRAGFTVQLSGHTHGGQFLPWPPFVRLQQPVIGGLNRIGAMWLYTSRGTGY
WGPPNRFGVPSEITLIRLTRGS
Download sequence
Identical sequences A0A132D385 A4JPK4 I2DX12
269482.Bcep1808_5258 WP_011882530.1.100586 WP_011882530.1.11466 WP_011882530.1.16060 WP_011882530.1.17582 WP_011882530.1.20738 WP_011882530.1.29019 WP_011882530.1.34430 WP_011882530.1.42332 WP_011882530.1.56091 WP_011882530.1.58403 WP_011882530.1.59706 WP_011882530.1.62776 WP_011882530.1.68849 WP_011882530.1.72014 WP_011882530.1.81796 WP_011882530.1.85937 WP_011882530.1.86980 WP_011882530.1.95492 gi|134293936|ref|YP_001117672.1| gi|387905581|ref|YP_006335919.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]