SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134294350|ref|YP_001118085.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134294350|ref|YP_001118085.1|
Domain Number 1 Region: 5-274
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.16e-100
Family Methylenetetrahydrofolate reductase 0.000000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134294350|ref|YP_001118085.1|
Sequence length 276
Comment 5,10-methylenetetrahydrofolate reductase [Burkholderia vietnamiensis G4]
Sequence
MKPIELSFEFFPPKTADGVEKLRATRAQLLPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
DGLEAAPHLSCIGSSRDSLRAILDQYRSHGIRHIVALRGDLPSGMGEVGELRYASELVSF
IRAEHGDWFHIEVAGYPEYHPQSRSPAADLQNFARKVKAGANSAITQYFFNADAYFRFVD
DARKLGVDVPIVPGIMPITNFSQLMRFSEMCGAEVPRWVARRLESFGDDRDAIRAFGADV
VTGLCQRLIDAGVPGLHFYTLNAAAATRTICERLTM
Download sequence
Identical sequences A0A132E2H5 A4JAE7
269482.Bcep1808_0234 gi|134294350|ref|YP_001118085.1| WP_011882924.1.100533 WP_011882924.1.100586 WP_011882924.1.11466 WP_011882924.1.16060 WP_011882924.1.17582 WP_011882924.1.20738 WP_011882924.1.22835 WP_011882924.1.242 WP_011882924.1.24430 WP_011882924.1.29019 WP_011882924.1.40662 WP_011882924.1.42332 WP_011882924.1.4627 WP_011882924.1.48957 WP_011882924.1.56091 WP_011882924.1.57845 WP_011882924.1.58403 WP_011882924.1.58797 WP_011882924.1.59706 WP_011882924.1.60365 WP_011882924.1.61106 WP_011882924.1.62776 WP_011882924.1.66494 WP_011882924.1.68849 WP_011882924.1.72014 WP_011882924.1.81796 WP_011882924.1.82398 WP_011882924.1.82744 WP_011882924.1.85080 WP_011882924.1.85937 WP_011882924.1.86522 WP_011882924.1.86980 WP_011882924.1.95492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]