SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134295249|ref|YP_001118984.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134295249|ref|YP_001118984.1|
Domain Number 1 Region: 1-258
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.28e-58
Family GpdQ-like 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134295249|ref|YP_001118984.1|
Sequence length 274
Comment metallophosphoesterase [Burkholderia vietnamiensis G4]
Sequence
MLLAQISDLHIKRPGQLAYRRVDTAAALARCIAKLNALTPRPDAVLVTGDLTDFGHDDEY
RHLRALLAPLEIPYYLMVGNHDDRAALRRAFPERAELHDGAFVQYALDIGAVRVLALDSQ
VPGASHGDLCDARLAWLAAQLDAARERPVIVALHHPPFASGIGHMDALRLAPAAAAKLDA
LLRGHPNVERVLCGHVHRTMFTRFGGTLAAAVPAPAHQVAFDLRADAPSAFRLEPPAFAV
HAHAPETGVVSHHVYVDEGDGPYPFYEPSGELVD
Download sequence
Identical sequences A4JCZ6
WP_011884102.1.16060 WP_011884102.1.242 WP_011884102.1.34430 WP_011884102.1.4627 WP_011884102.1.56091 WP_011884102.1.58403 WP_011884102.1.68849 WP_011884102.1.95492 269482.Bcep1808_1138 gi|134295249|ref|YP_001118984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]