SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134295521|ref|YP_001119256.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134295521|ref|YP_001119256.1|
Domain Number 1 Region: 1-112,169-259
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.06e-29
Family GpdQ-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134295521|ref|YP_001119256.1|
Sequence length 275
Comment metallophosphoesterase [Burkholderia vietnamiensis G4]
Sequence
MRVRVLSDLHLESNQPDAIAHAEADLVVLAGDIHNHAEGLRWAAETFDARVPVIYVPGNH
EYYDGEFGALETAMRDAAHTLDNVHYLNNGLYVDPAQRFRVLGTTLWTDFSLFGADDASV
ARATEAGMRVMLDFKGLIQVTWPHEASTRPGDAPQRDFTPADAIALHRHSRAWLAARIAT
PFAGRTIVVTHHAPHLRSLAQRYEEDLASAGFVTDLAELVRPPVDLWVHGHTHTSFDYVT
DSGTRVVCNPRGYIRRRTGELENPAFAWDRVVELG
Download sequence
Identical sequences A0A132DJ25 A4JDR8
gi|134295521|ref|YP_001119256.1| 269482.Bcep1808_1413 WP_011884514.1.100533 WP_011884514.1.22835 WP_011884514.1.34430 WP_011884514.1.40662 WP_011884514.1.48957 WP_011884514.1.68849 WP_011884514.1.74552 WP_011884514.1.75555 WP_011884514.1.85080 WP_011884514.1.85937 WP_011884514.1.86980 WP_011884514.1.91243 WP_011884514.1.95492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]