SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134296087|ref|YP_001119822.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134296087|ref|YP_001119822.1|
Domain Number 1 Region: 27-241
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.73e-27
Family DNA double-strand break repair nuclease 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134296087|ref|YP_001119822.1|
Sequence length 266
Comment UDP-2,3-diacylglucosamine hydrolase [Burkholderia vietnamiensis G4]
Sequence
MLQESPPRSVSAGVPGEREYAHAARPFLFLSDLHLSDAIPKTVAAFEHFVKYTADSADSV
FILGDLFEYWIGDDVLDDDPFAARMAALMHTFSERGIALYVMHGNRDFLLGRRFMKAAGA
MLLPDPALITAFGQRIVLAHGDAQCTADRRYQIFRRFARNRVAQALFLAWPFRWRRALAQ
RMRSNSEAGRMRPVSAAYDVTRDGVAALFRKGRASVIIHGHTHRPARHAEPGGIRWVLPD
WDLDHGMPRGGYLRVDAEGIHAMPLD
Download sequence
Identical sequences A0A103GSB7 A4JFD4
gi|134296087|ref|YP_001119822.1| 269482.Bcep1808_1984 WP_011885202.1.15885 WP_011885202.1.1808 WP_011885202.1.22835 WP_011885202.1.23278 WP_011885202.1.24430 WP_011885202.1.24445 WP_011885202.1.29019 WP_011885202.1.35901 WP_011885202.1.40662 WP_011885202.1.44217 WP_011885202.1.48957 WP_011885202.1.60365 WP_011885202.1.61106 WP_011885202.1.74552 WP_011885202.1.75555 WP_011885202.1.85080 WP_011885202.1.86522 WP_011885202.1.91243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]