SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134296271|ref|YP_001120006.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134296271|ref|YP_001120006.1|
Domain Number 1 Region: 60-126,156-208
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.0000000154
Family GpdQ-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134296271|ref|YP_001120006.1|
Sequence length 423
Comment hypothetical protein Bcep1808_2169 [Burkholderia vietnamiensis G4]
Sequence
MPTGTHKRVARGRRAGLAAALTVAALTLATAGALAATPKRGAAPYSFAVVSSVIDVPADE
PAAQRLFEAIARERSVAFVVYAGDIKGAKEACRDSLYAQRGAILSATRVPLVFIPGNHDW
VTCGTAAGGGYDPVERLDFLRQTLLADTALPDPGALPITRESEVARFRPYRENARWIRDD
VVYIALNAPGPNNHFLTAGGRNGEFEDRVIANGFWLDHAAEFAKRREARAMVVIFEGDPQ
FDRYERAERFAWLRFNRPRARDGFRELKRALVKAAATFRGPILVMHASGEPLANGFLIDR
PLHADDGALVGNVTRVAFGPRHPAHQWVKVNVSPARQTVFSVSLQDVPKDVPVPPALPAA
PRNDVPLPQMPEIPALPALPDASSVAPPLQGDGTTPAGASWPAPPPASGPASGQPASSVQ
GAP
Download sequence
Identical sequences A0A132E0F9 A4JFW8
WP_011885379.1.100586 WP_011885379.1.62776 WP_011885379.1.66494 WP_011885379.1.82744 269482.Bcep1808_2169 gi|134296271|ref|YP_001120006.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]