SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134296454|ref|YP_001120189.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134296454|ref|YP_001120189.1|
Domain Number 1 Region: 56-174,233-294
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.8e-32
Family YfcE-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134296454|ref|YP_001120189.1|
Sequence length 312
Comment metallophosphoesterase [Burkholderia vietnamiensis G4]
Sequence
MGQKTSATSLFRQPIGARAATAFLSGAAAAGALSPHEPPAAHATQHDDSESSMHRYRTIW
LSDIHLGSSGCQAPYLLDFLRHNDSEYLYLVGDIIDGWQLKKGWYWPQAHNDVVQKILRK
ARKGTQVVYIPGNHDEGARQFCDLAFGDIQVRGEAFHTTLAGKRLWIVHGDLFDGVIQHA
KWLAYLGDTLYTLILVLNRWFNRIRSRLGFQYWSLSQYLKHQVKNAVNFISKFENVMTDE
ARRRGCDGVVCGHIHKAEIRDIDGVLYCNDGDWVESLSALVETTEGELKVVYWTAMRAAP
SAAPSRKAKAAA
Download sequence
Identical sequences A0A132DV03 A4JGF1 I2DP45
WP_011885552.1.100533 WP_011885552.1.100586 WP_011885552.1.11466 WP_011885552.1.16060 WP_011885552.1.17582 WP_011885552.1.20738 WP_011885552.1.22835 WP_011885552.1.242 WP_011885552.1.29019 WP_011885552.1.34430 WP_011885552.1.40662 WP_011885552.1.42332 WP_011885552.1.4627 WP_011885552.1.48957 WP_011885552.1.56091 WP_011885552.1.57845 WP_011885552.1.58403 WP_011885552.1.59706 WP_011885552.1.60365 WP_011885552.1.61106 WP_011885552.1.62776 WP_011885552.1.66494 WP_011885552.1.68849 WP_011885552.1.72014 WP_011885552.1.74552 WP_011885552.1.81796 WP_011885552.1.82398 WP_011885552.1.82744 WP_011885552.1.85080 WP_011885552.1.85937 WP_011885552.1.86522 WP_011885552.1.86980 WP_011885552.1.95492 269482.Bcep1808_2355 gi|134296454|ref|YP_001120189.1| gi|387902813|ref|YP_006333152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]