SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|134297088|ref|YP_001120823.1| from Burkholderia vietnamiensis G4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134297088|ref|YP_001120823.1|
Domain Number 1 Region: 46-406
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.71e-74
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00066
Further Details:      
 
Domain Number 2 Region: 407-630
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 5.1e-40
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134297088|ref|YP_001120823.1|
Sequence length 688
Comment 5'-nucleotidase domain-containing protein [Burkholderia vietnamiensis G4]
Sequence
MRLPPLSRRRVRTAAALASLAFALAGCGGDDVTASAPQTQAQAPAGTTATLALLETTDLH
TNVLSYDYFKLAADNSLGFERVSTLIAQARAQYPNSLLLDNGDTIQGTALADYQALVKPL
GCDQTLAIYKVMNAARFDGGGIGNHEFNYGLPYLSQVTGNTFDVDGLPAPAQQKKCAGPN
FPQVLANVISAKTNAPLFTPYTILTRTVTAVTPDGKTVSAPVKVGIIGFTPPAIMSWDKR
WLDGKVYTTGLKEAAEKYIPEMRAKGADLVVAISHGGLDNTPYSPTMENGSWWLSTVPGI
DAMLIGHSHQVFPDANSTVAQFNLPGVDKVKGTVNGVPTVMANYWGKHLGVIKLGLKFDG
KTWSVDKSQTTVEARPIQNADKSYVAADPSVSAAIAAEHQATIDYVKTPIGSTDYRMNSY
FADVGDPGAIQIVNEAQADYVKTYVQANLPQYASLPVLSVSAPFKSGFGGGSDYTDVAPG
ALAINNAADLYLYPNTVYAVKVSGADVKNWLETAAKRFNTIDPTKATVQPLVSSFPGYNF
DMFTSADLAYEIDVTQPVGSRIRNLTYKGAPLDPNAQFIVATNNYRASGGGNFPGLDGSK
TIFASPDANRDVLIAFIKKRGTITRAADGAQRSWRFTKLASSLAHVRFTSAPNRLADATA
AGLTGLTQVTADDGSGKNLAIYEIDLTQ
Download sequence
Identical sequences A0A132DLP3 A4JI85
269482.Bcep1808_2997 WP_011886151.1.82744 gi|134297088|ref|YP_001120823.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]