SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118476707|ref|YP_893858.1| from Bacillus thuringiensis str. Al Hakam

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118476707|ref|YP_893858.1|
Domain Number 1 Region: 133-300
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.05e-29
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.034
Further Details:      
 
Domain Number 2 Region: 58-111
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000134
Family AraC type transcriptional activator 0.0024
Further Details:      
 
Domain Number 3 Region: 7-56
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000896
Family AraC type transcriptional activator 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118476707|ref|YP_893858.1|
Sequence length 300
Comment AraC family transcriptional regulator [Bacillus thuringiensis str. Al Hakam]
Sequence
MESYETQIQRSIDYIEEDVMEKQTLRNLARIAGFSESHFHRVFQALVGDTVMEYVRKRRL
ARAAYQLSHTDEKIIDIAFEHGFQSHETFTRAFKKLFQMTPSEYRKQEIETPMYSSVNVK
QRKLNPYLGGIQMEYRIVNKPEFLMAGYELKTTSKEGKNHQDIPAFWQEYLQKDLGTTIP
NRKDTSQWVELGLCTDFNLETGDFTYIIGMEVTDFENVPNEIAKRTFPAATYAVFTTPKV
PHEEMVSSIHQTWNAVFSEWFPHSGYEHCGVNEFELYDERSHADKSEFAQIELWIPVKKK
Download sequence
Identical sequences A0RAV8 B3ZM94
gi|118476707|ref|YP_893858.1| 412694.BALH_0986 WP_000446827.1.13221 WP_000446827.1.23873 WP_000446827.1.26000 WP_000446827.1.33828 WP_000446827.1.46476 WP_000446827.1.4649 WP_000446827.1.62300 WP_000446827.1.782 WP_000446827.1.9269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]