SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118478368|ref|YP_895519.1| from Bacillus thuringiensis str. Al Hakam

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118478368|ref|YP_895519.1|
Domain Number 1 Region: 135-294
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.88e-36
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0018
Further Details:      
 
Domain Number 2 Region: 65-115
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000493
Family AraC type transcriptional activator 0.0084
Further Details:      
 
Domain Number 3 Region: 12-62
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000424
Family AraC type transcriptional activator 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118478368|ref|YP_895519.1|
Sequence length 296
Comment AraC family transcriptional regulator [Bacillus thuringiensis str. Al Hakam]
Sequence
MENKQSRNEYLQRIYKVQNYIELHINDSLSIEELADIAGFSKYHFHRIFKGVVDEPLSRY
VNRLKLERATNLLTYRSDMTITDIAYHFGFTDSAVFSRTFKNYYGVSPSQYRNDNSKNCK
DVRRTSQYNECKKVRGNVEIVAADNINVAYIRHIGTYEELTIAFPKMIEKLFHYAAKQNY
HVFKDTKVLTIYHDHHEFTEDNHLRTSLCITIPGESAIETNDIGIMVIPSGKYAVGHFEI
FQDEYKRAWDFIYGEWLPNSGYKPRDSYPFEVYRNDPKQHPKHKHIVDIYVPIEPF
Download sequence
Identical sequences A0RFL9
gi|118478368|ref|YP_895519.1| WP_000428661.1.33828 WP_000428661.1.46476 412694.BALH_2732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]