SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118480068|ref|YP_897219.1| from Bacillus thuringiensis str. Al Hakam

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118480068|ref|YP_897219.1|
Domain Number 1 Region: 27-266
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.35e-80
Family Phosphate binding protein-like 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118480068|ref|YP_897219.1|
Sequence length 268
Comment ABC transporter substrate-binding protein [Bacillus thuringiensis str. Al Hakam]
Sequence
MKKILLSVVTALSVFTLAACGGKEENKLVVGASNVPHAVILEKAQPILEKKGIKLEIKKF
QDYVLPNKALADKEIDANYFQHIPYLDKEIQEKGYKIVNAGKIHLEPMGIYSKKYKSLKD
LPDGGTVIMSNNVAERGRMLALLQKGGVIKLKDGVDVVKATVKDVVENPKNLKFKTDVEP
GLSPKLYENNEGDALFINSNYAIDAKLNPTKDAISIEGSDSPYANIIAVRKGDEKKKEIK
ELVEVLHSKEIQDFINKEYKGAVLPVSE
Download sequence
Identical sequences A0A150B491 A0A242W619 A0RKG9 B3ZLM5 C2NPW1 C3GA54
WP_000722404.1.101931 WP_000722404.1.11387 WP_000722404.1.24676 WP_000722404.1.26000 WP_000722404.1.33828 WP_000722404.1.3699 WP_000722404.1.41365 WP_000722404.1.46476 WP_000722404.1.55968 WP_000722404.1.56580 WP_000722404.1.60841 WP_000722404.1.62300 WP_000722404.1.66357 WP_000722404.1.67239 WP_000722404.1.69323 WP_000722404.1.85901 WP_000722404.1.90155 WP_000722404.1.9269 412694.BALH_4516 gi|118480068|ref|YP_897219.1| gi|376268889|ref|YP_005121601.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]