SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118476062|ref|YP_893213.1| from Bacillus thuringiensis str. Al Hakam

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118476062|ref|YP_893213.1|
Domain Number 1 Region: 35-273
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.39e-82
Family Phosphate binding protein-like 0.000000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118476062|ref|YP_893213.1|
Sequence length 284
Comment ABC transporter substrate-binding protein [Bacillus thuringiensis str. Al Hakam]
Sequence
MKKILAFALSAIVGVSALSGCSSGDTGAGAKEKVVRVGVTGTDGDAWEILKRKAEKEGIK
IKLVEFSDYTTPNKALADGDIELNSFQHIAFLEQFKKEHKLDITAVGTTQIAPMGLYSEK
YKKANEIPDGSEIAIPNDPTNQARALKLLDAAGLLKLKKDFGLFGDPSGIAENPKKLKIT
PVIAQQTPRVLKDVAASVINNGVAGQAGLDPAKDPIFLEDPKNENAKPYINIFAARTKDK
DDPTLKKVIELYHSKEVTDAIKKETNDGSISVDLSLDELEKIVK
Download sequence
Identical sequences A0A0K6MGI3 A0A158RT56 A0A1N7UMU6 A0A242WFD4 A0A243D291 A0A2B6CBH5 A0R913 B3ZPX2 C2NC82 C2TAW7 D8GYS1 F0PUE1
gi|118476062|ref|YP_893213.1| gi|225862352|ref|YP_002747730.1| gi|376264325|ref|YP_005117037.1| gi|301052026|ref|YP_003790237.1| gi|384178229|ref|YP_005563991.1| 412694.BALH_0305 572264.BCA_0388 WP_000721604.1.100241 WP_000721604.1.100409 WP_000721604.1.16013 WP_000721604.1.21172 WP_000721604.1.24676 WP_000721604.1.25316 WP_000721604.1.2569 WP_000721604.1.26000 WP_000721604.1.29804 WP_000721604.1.33828 WP_000721604.1.3699 WP_000721604.1.41365 WP_000721604.1.44483 WP_000721604.1.45919 WP_000721604.1.46476 WP_000721604.1.4649 WP_000721604.1.55968 WP_000721604.1.60841 WP_000721604.1.62300 WP_000721604.1.63137 WP_000721604.1.63611 WP_000721604.1.67239 WP_000721604.1.69323 WP_000721604.1.71895 WP_000721604.1.80964 WP_000721604.1.85901 WP_000721604.1.91569 WP_000721604.1.9269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]