SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118476114|ref|YP_893265.1| from Bacillus thuringiensis str. Al Hakam

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118476114|ref|YP_893265.1|
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.4e-69
Family Phosphate binding protein-like 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118476114|ref|YP_893265.1|
Sequence length 264
Comment amino acid ABC transporter periplasmic-binding protein [Bacillus thuringiensis str. Al Hakam]
Sequence
MKRKLLTIVASITLCTSFILGACSKESSTTSSNGEKEFRYAMSGLYKPFNYKENDGKLAG
FDVEIGEALAKKMNMKPTPITNPWETLIQGLKAKKYDAILGSMAITEERLKAVNFSNPYY
RSGAQIFVAKKNTSISSPEDLKGKKIGVVKASTFKDLVAKHTDQITEYDSDITALMDLEP
GRIDAVITDQMVGLRMIKEGKSNIKEAGKPLNLDEMGIAIRKDDKEMAEKVNKALDEIIK
DGTYEKISKKWFGRNILGEEEKTK
Download sequence
Identical sequences A0A242XP13 A0A2A8WIU0 A0A2B1DW25 A0R965
gi|118476114|ref|YP_893265.1| 412694.BALH_0358 WP_000823747.1.33828 WP_000823747.1.46476 WP_000823747.1.62918 WP_000823747.1.6716 WP_000823747.1.70018 WP_000823747.1.83228 WP_000823747.1.89460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]