SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118476506|ref|YP_893657.1| from Bacillus thuringiensis str. Al Hakam

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118476506|ref|YP_893657.1|
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.54e-68
Family Phosphate binding protein-like 0.0000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118476506|ref|YP_893657.1|
Sequence length 265
Comment amino acid ABC transporter amino acid-binding protein [Bacillus thuringiensis str. Al Hakam]
Sequence
MKKLFSVLAVTTLAIGIVAGCGKEEKKDTASQDALQKIKQSGELVIGTEGTYPPFTFHDS
SNKLTGFDVELAEEVAKRLGVKPVFKETQWDSLLAGLDAKRFDMVANEVGIREDRQKKYD
FSKPYVSSSAVLVIAKDKDKPATFADVKGLKAAQSLTSNYADIAKKNGAEITNVEGFSQA
AELLNTGRVDFTINDKLSVLNYLETKKDAKIKIVDTEKEASQSGFLFRKGSDKLVQEVDK
ALEDMKKDGTYDKIAKKWFGENVSK
Download sequence
Identical sequences A0A0K6N2B9 A0A0L1NJM2 A0A158RTS1 A0A1D3PCZ2 A0A1J9V308 A0A1V6LL14 A0A242WHL3 A0A242WYZ0 A0A243IVS2 A0RAA7 B3ZUU7 C2NDA9 C2V7T5 C2WYV4 J8JAX5 K0FHS0 R8M689
gi|376264809|ref|YP_005117521.1| gi|118476506|ref|YP_893657.1| gi|407703367|ref|YP_006826952.1| 412694.BALH_0774 572264.BCA_0912 gi|557622972|ref|YP_008784104.1| gi|225862823|ref|YP_002748201.1| WP_000732848.1.100095 WP_000732848.1.100771 WP_000732848.1.11380 WP_000732848.1.13221 WP_000732848.1.13424 WP_000732848.1.14084 WP_000732848.1.23873 WP_000732848.1.2407 WP_000732848.1.24676 WP_000732848.1.24792 WP_000732848.1.24969 WP_000732848.1.24992 WP_000732848.1.2569 WP_000732848.1.26000 WP_000732848.1.30144 WP_000732848.1.3196 WP_000732848.1.33828 WP_000732848.1.3699 WP_000732848.1.37626 WP_000732848.1.37661 WP_000732848.1.40839 WP_000732848.1.42182 WP_000732848.1.42747 WP_000732848.1.42941 WP_000732848.1.44483 WP_000732848.1.4453 WP_000732848.1.46476 WP_000732848.1.4649 WP_000732848.1.46586 WP_000732848.1.474 WP_000732848.1.4865 WP_000732848.1.499 WP_000732848.1.52532 WP_000732848.1.54419 WP_000732848.1.55893 WP_000732848.1.5841 WP_000732848.1.59978 WP_000732848.1.60012 WP_000732848.1.62300 WP_000732848.1.64770 WP_000732848.1.70209 WP_000732848.1.74337 WP_000732848.1.75358 WP_000732848.1.75374 WP_000732848.1.77968 WP_000732848.1.782 WP_000732848.1.7856 WP_000732848.1.84323 WP_000732848.1.86041 WP_000732848.1.89698 WP_000732848.1.9269 WP_000732848.1.93904 WP_000732848.1.94270 WP_000732848.1.98519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]