SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118476894|ref|YP_894045.1| from Bacillus thuringiensis str. Al Hakam

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118476894|ref|YP_894045.1|
Domain Number 1 Region: 40-348
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.39e-70
Family Phosphate binding protein-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118476894|ref|YP_894045.1|
Sequence length 358
Comment ABC transporter substrate-binding protein [Bacillus thuringiensis str. Al Hakam]
Sequence
MKKTIFKAVATGMVFSLLMGCGAKKEESAGAKVKDDKLSGSLTVYTAIEEELVPIYLDSF
KKKYPDVKLNIVRDSTGVITAKLLAEGKNTQADVVWGTAASSLLALDKKDMLKGYSPKGA
DRVLPQFKDDKQPEKWVGNTAFMTGIAINKEELKKKNLPMPESYEDLTKPEYKGTLVMPH
PASSGTGFLTVSAWLQIMGEDKGWDYMKKLHDNMATYTHSGSKPAKLAGAGEYPVGVSMV
YSALKEKQKGAPVEVVLPKEGLGWEVEANALIKKDNAKNEKLAQAFLDWAITDDVMKLYF
EKNGFATIKNDYKLPDGFPKDVTEKLYKKNDFKWAAENRDKILEKWEKEFGQKAEPKK
Download sequence
Identical sequences A0A0B5NKR4 A0A0G8DIL6 A0A0J1HZ70 A0A0K6N3G6 A0A158RRT8 A0A1J9TC13 A0A1J9ZF90 A0A1J9ZII9 A0A242W104 A0A243BFI8 A0A243BSN3 A0A243CSP4 A0A243HTU0 A0A246PVR3 A0A2C4H938 A0A2C9YHU0 A0RBE5 B3ZC40 B3ZTK4 B7JFQ5 C2NET2 C2QQ68 C2TDQ3 C2VQX7 C3BZL2 C3GFZ6 J8D4C3 J8IQM3 Q63E49 Q6HLM4 Q81TE3
gi|118476894|ref|YP_894045.1| gi|52144015|ref|YP_082813.1| gi|229603538|ref|YP_002865838.1| gi|225863284|ref|YP_002748662.1| gi|386735123|ref|YP_006208304.1| gi|376265262|ref|YP_005117974.1| gi|30261424|ref|NP_843801.1| 198094.BA_1337 260799.BAS1235 261594.GBAA1337 281309.BT9727_1212 288681.BCZK1214 405535.BCAH820_1411 412694.BALH_1186 568206.BAMEG_3260 572264.BCA_1375 592021.BAA_1403 gi|227815836|ref|YP_002815845.1| NP_843801.1.87267 WP_000750887.1.100059 WP_000750887.1.100214 WP_000750887.1.100409 WP_000750887.1.100595 WP_000750887.1.100873 WP_000750887.1.101140 WP_000750887.1.101550 WP_000750887.1.101843 WP_000750887.1.101931 WP_000750887.1.10208 WP_000750887.1.11044 WP_000750887.1.11060 WP_000750887.1.11387 WP_000750887.1.11427 WP_000750887.1.11676 WP_000750887.1.1228 WP_000750887.1.13115 WP_000750887.1.13221 WP_000750887.1.13233 WP_000750887.1.13820 WP_000750887.1.14721 WP_000750887.1.14882 WP_000750887.1.15163 WP_000750887.1.15460 WP_000750887.1.15569 WP_000750887.1.16013 WP_000750887.1.16156 WP_000750887.1.16170 WP_000750887.1.16997 WP_000750887.1.17146 WP_000750887.1.17265 WP_000750887.1.17424 WP_000750887.1.17899 WP_000750887.1.1809 WP_000750887.1.1850 WP_000750887.1.18976 WP_000750887.1.19173 WP_000750887.1.19258 WP_000750887.1.19435 WP_000750887.1.20390 WP_000750887.1.20680 WP_000750887.1.20865 WP_000750887.1.20973 WP_000750887.1.21021 WP_000750887.1.21258 WP_000750887.1.21776 WP_000750887.1.22865 WP_000750887.1.23110 WP_000750887.1.23200 WP_000750887.1.23269 WP_000750887.1.23615 WP_000750887.1.23873 WP_000750887.1.24182 WP_000750887.1.2419 WP_000750887.1.24334 WP_000750887.1.24556 WP_000750887.1.24608 WP_000750887.1.24676 WP_000750887.1.24709 WP_000750887.1.24759 WP_000750887.1.2521 WP_000750887.1.25316 WP_000750887.1.2569 WP_000750887.1.25716 WP_000750887.1.25752 WP_000750887.1.25757 WP_000750887.1.26000 WP_000750887.1.2618 WP_000750887.1.26665 WP_000750887.1.26721 WP_000750887.1.27987 WP_000750887.1.28427 WP_000750887.1.28729 WP_000750887.1.29101 WP_000750887.1.29451 WP_000750887.1.29787 WP_000750887.1.29804 WP_000750887.1.30110 WP_000750887.1.30216 WP_000750887.1.30317 WP_000750887.1.30336 WP_000750887.1.31490 WP_000750887.1.3236 WP_000750887.1.32576 WP_000750887.1.33338 WP_000750887.1.33367 WP_000750887.1.33536 WP_000750887.1.33740 WP_000750887.1.33828 WP_000750887.1.33876 WP_000750887.1.34158 WP_000750887.1.34646 WP_000750887.1.3561 WP_000750887.1.35684 WP_000750887.1.35886 WP_000750887.1.3612 WP_000750887.1.36305 WP_000750887.1.36763 WP_000750887.1.3699 WP_000750887.1.37626 WP_000750887.1.38036 WP_000750887.1.38425 WP_000750887.1.38517 WP_000750887.1.39001 WP_000750887.1.39781 WP_000750887.1.40550 WP_000750887.1.40839 WP_000750887.1.41165 WP_000750887.1.41675 WP_000750887.1.41976 WP_000750887.1.42165 WP_000750887.1.42217 WP_000750887.1.43104 WP_000750887.1.43533 WP_000750887.1.4439 WP_000750887.1.44483 WP_000750887.1.45089 WP_000750887.1.45305 WP_000750887.1.45385 WP_000750887.1.45533 WP_000750887.1.45919 WP_000750887.1.46236 WP_000750887.1.46244 WP_000750887.1.46476 WP_000750887.1.4649 WP_000750887.1.46549 WP_000750887.1.46699 WP_000750887.1.47145 WP_000750887.1.47441 WP_000750887.1.4763 WP_000750887.1.47798 WP_000750887.1.47936 WP_000750887.1.48010 WP_000750887.1.49802 WP_000750887.1.49831 WP_000750887.1.50770 WP_000750887.1.51099 WP_000750887.1.51656 WP_000750887.1.52494 WP_000750887.1.52794 WP_000750887.1.53137 WP_000750887.1.53493 WP_000750887.1.53621 WP_000750887.1.53683 WP_000750887.1.53879 WP_000750887.1.54117 WP_000750887.1.54189 WP_000750887.1.55811 WP_000750887.1.55958 WP_000750887.1.55968 WP_000750887.1.56042 WP_000750887.1.56176 WP_000750887.1.56270 WP_000750887.1.5628 WP_000750887.1.56318 WP_000750887.1.57245 WP_000750887.1.58037 WP_000750887.1.58160 WP_000750887.1.59052 WP_000750887.1.59095 WP_000750887.1.59173 WP_000750887.1.59310 WP_000750887.1.59575 WP_000750887.1.59978 WP_000750887.1.60402 WP_000750887.1.60781 WP_000750887.1.60841 WP_000750887.1.61213 WP_000750887.1.61231 WP_000750887.1.61944 WP_000750887.1.62107 WP_000750887.1.62300 WP_000750887.1.63137 WP_000750887.1.63560 WP_000750887.1.63611 WP_000750887.1.64491 WP_000750887.1.64615 WP_000750887.1.64706 WP_000750887.1.65758 WP_000750887.1.65983 WP_000750887.1.66331 WP_000750887.1.66357 WP_000750887.1.66932 WP_000750887.1.67108 WP_000750887.1.67239 WP_000750887.1.68607 WP_000750887.1.69203 WP_000750887.1.69323 WP_000750887.1.69822 WP_000750887.1.69894 WP_000750887.1.70065 WP_000750887.1.7096 WP_000750887.1.70996 WP_000750887.1.71441 WP_000750887.1.71648 WP_000750887.1.72704 WP_000750887.1.73325 WP_000750887.1.74226 WP_000750887.1.74337 WP_000750887.1.74538 WP_000750887.1.7545 WP_000750887.1.75499 WP_000750887.1.75870 WP_000750887.1.76125 WP_000750887.1.77370 WP_000750887.1.77668 WP_000750887.1.77824 WP_000750887.1.77902 WP_000750887.1.782 WP_000750887.1.7856 WP_000750887.1.78644 WP_000750887.1.79043 WP_000750887.1.79250 WP_000750887.1.79315 WP_000750887.1.79584 WP_000750887.1.80239 WP_000750887.1.80439 WP_000750887.1.80571 WP_000750887.1.80695 WP_000750887.1.80955 WP_000750887.1.81799 WP_000750887.1.82289 WP_000750887.1.82421 WP_000750887.1.83070 WP_000750887.1.83951 WP_000750887.1.84045 WP_000750887.1.84422 WP_000750887.1.85689 WP_000750887.1.85901 WP_000750887.1.86082 WP_000750887.1.86119 WP_000750887.1.86140 WP_000750887.1.86239 WP_000750887.1.86288 WP_000750887.1.8698 WP_000750887.1.87627 WP_000750887.1.8825 WP_000750887.1.88431 WP_000750887.1.88641 WP_000750887.1.90596 WP_000750887.1.90671 WP_000750887.1.90791 WP_000750887.1.90883 WP_000750887.1.9186 WP_000750887.1.92347 WP_000750887.1.92686 WP_000750887.1.9269 WP_000750887.1.92831 WP_000750887.1.93271 WP_000750887.1.93893 WP_000750887.1.93927 WP_000750887.1.94237 WP_000750887.1.94322 WP_000750887.1.94373 WP_000750887.1.94784 WP_000750887.1.95308 WP_000750887.1.96356 WP_000750887.1.96934 WP_000750887.1.97149 WP_000750887.1.97617 WP_000750887.1.97781 WP_000750887.1.97861 WP_000750887.1.98216 WP_000750887.1.98557 WP_000750887.1.98571 WP_000750887.1.99445 WP_000750887.1.99454 WP_000750887.1.99485 YP_027504.1.16718 YP_035547.1.62562 gi|49479772|ref|YP_035547.1| gi|49184252|ref|YP_027504.1| gi|218902528|ref|YP_002450362.1| gi|402553196|ref|YP_006594467.1| gi|47777921|ref|YP_017952.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]