SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118478252|ref|YP_895403.1| from Bacillus thuringiensis str. Al Hakam

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118478252|ref|YP_895403.1|
Domain Number 1 Region: 31-258
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.28e-52
Family Phosphate binding protein-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118478252|ref|YP_895403.1|
Sequence length 328
Comment alkanesulfonates-binding protein [Bacillus thuringiensis str. Al Hakam]
Sequence
MYKKFKVLSFTLAISLFLFGCEKSTASSKKEDVTVQIGIQQGLSPLLLAQKKGWFEEEFK
KEGVKVKWTEFQSGPPYFEAIASNRLDFGEVGNSPVISAQAAGIEFTEIANTSYARKGTG
ILVQKDSKITSVKELKGKKIAVAKGSSAFNLLYRALDKEGIDAKDVNVIQLQPDEAQPAF
ESGSVDAWAIWDPFISLHTVNKGAKVITDGEILNVSSPEFLIARTKFAKEHPELVEKFLK
VYEKARVWQDENLDEAIKIYTSAKKIDAEIVKEVFHHDKPILVPVTKEIIAEQQKTANFQ
YKLGSIKKEIKTDKVVDNSFVEKALKAK
Download sequence
Identical sequences A0RFA3 B3ZJ46
412694.BALH_2613 gi|118478252|ref|YP_895403.1| WP_000276932.1.26000 WP_000276932.1.33828 WP_000276932.1.46476 WP_000276932.1.4649 WP_000276932.1.62300 WP_000276932.1.69323 WP_000276932.1.9269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]