SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118480298|ref|YP_897449.1| from Bacillus thuringiensis str. Al Hakam

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118480298|ref|YP_897449.1|
Domain Number 1 Region: 42-307
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.19e-51
Family Phosphate binding protein-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118480298|ref|YP_897449.1|
Sequence length 344
Comment ABC transporter substrate-binding protein [Bacillus thuringiensis str. Al Hakam]
Sequence
MRKIAFFFFLLVIGGAMSSCSRDTTSIKYNKSGLPILDDRHLVAYVAAREEVGEALLSSF
CKPRGCTYEFIRLSTEELLRRVEEEAGNPKADIIIGGTVDAHQMMKQKKLSIPVTSQHAN
RISKTVKDKDGYWYGYEVEKLAIAINKERWNEEIAPLGLPYPSRWQDLLNPVYKEKIVMP
DPNVSGTAYTFFQSLIDTVGEEEAKEYVKSFAGQVGEVTVNGYMPVELVASGEYMIGINF
MGDQRMLQKQGFPVVSIVPEQTGLSVNAISKLKRAPNGIIADLFIDYCLSEEAGHILEKV
SFGVPTMFAKNEKEIEGQPVRRTNQNISNSGIIEIWNRQRLSQK
Download sequence
Identical sequences A0A158RQW5 A0RL49 B3ZRF3
gi|118480298|ref|YP_897449.1| 412694.BALH_4759 572264.BCA_5399 gi|225867231|ref|YP_002752609.1| WP_001225604.1.13221 WP_001225604.1.23873 WP_001225604.1.24676 WP_001225604.1.2569 WP_001225604.1.26000 WP_001225604.1.33828 WP_001225604.1.44483 WP_001225604.1.46476 WP_001225604.1.62300 WP_001225604.1.69323 WP_001225604.1.782 WP_001225604.1.9269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]