SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148271916|ref|YP_001221477.1| from Clavibacter michiganensis subsp. michiganensis NCPPB 382

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148271916|ref|YP_001221477.1|
Domain Number 1 Region: 3-482
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 3.79e-204
Family Heme-dependent catalases 0.0000000000943
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148271916|ref|YP_001221477.1|
Sequence length 509
Comment hypothetical protein CMM_0737 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
Sequence
MTDQKFTTTDSGAPVASDEHSLSVGPDGAIPLHDHYLVEKLAQFNRERIPERVVHAKGGG
AFGTFRVTGDVSAYTRASLFQPGAEVEMLARFSTVAGEQGSPDTWRDPRGFALKFYTDEG
NYDLVGNNTPVFFIRDGIKFPDFIRSQKRLPGSHLRDHDMQWDFWTLSPESAHQVTWLMG
DRGLPSSWRHMDGFGSHTYQWINAAGERFWVKYHFKTQQGIEILKQEQADQIAGEDADFH
IRDLTEAIDRGDYPEWKLEVQIMPYEEAKSYRFNPFDLTKVWSQKDYPRIEVGTMTLNRN
PENYFAQIEQAAFAPSNFVPGIQTSPDKMLLARIFSYADAHRYRVGTNHAQLPVNAPKSP
VHSYSKDGQGRYTFQDAGTPVYAPNSHGGAHADPARAAESAGWEQDGELVRAAATLHAED
DDFVQARMLVNESMDDAQRERLVGNIVGHVSKVTTAELRARVIQYWTNVDGWLGAAVAAG
LPPLAGDAPVAEATPGPTRDAEEVGVAAH
Download sequence
Identical sequences A0A1Y3FE11 A5CNX6
443906.CMM_0737 gi|148271916|ref|YP_001221477.1| WP_012037422.1.100120 WP_012037422.1.11755 WP_012037422.1.80587 WP_012037422.1.97611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]