SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148272214|ref|YP_001221775.1| from Clavibacter michiganensis subsp. michiganensis NCPPB 382

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148272214|ref|YP_001221775.1|
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.85e-30
Family Phosphoglucomutase, first 3 domains 0.00051
Further Details:      
 
Domain Number 2 Region: 161-269
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.63e-28
Family Phosphoglucomutase, first 3 domains 0.00014
Further Details:      
 
Domain Number 3 Region: 297-382
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.1e-22
Family Phosphoglucomutase, first 3 domains 0.0012
Further Details:      
 
Domain Number 4 Region: 386-474
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00000000000000116
Family Phosphoglucomutase, C-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148272214|ref|YP_001221775.1|
Sequence length 475
Comment phosphomannomutase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
Sequence
MTTTPAETLTAIVKTYDVRGLVGSQLTEELVTALGAGFVDELGAAGGEIVVGHDMRDSSP
SFAQAFARGATARGGNVLLIGLCSTDETYFASGSLDAPAVMFTASHNPATYNGLKFSRAG
AQGISLDTGLGAIRDRAIGFLADGIAAVEPAGQVRERDVLADYAGYLRQLVDLSGIRPLR
VVVDAGNGMGGMTVPAVLGTAAGLPELPIEIIPLYFELDGTFPNHEANPLEPANLVDLQK
AVVEHGADLGLAFDGDADRCFVVDEKGQAVTPSAVAAIVALREISRVKAQSPDEDVTVLH
NLITSRIVPETIEAAGATAVRTRVGHSLIKDQMAATGAVFGGEHSAHYYFRDFWGADNGM
LAAMHLLAEFGQTDGLMSDLSARYTPYALSGEINSTVDDVPAAYERIVEAFRGRGEFDEL
DGLTVDGPVGDDGSFWWFSVRPSNTEPLLRLNVEASTEAKMAALRDELLGLIRGA
Download sequence
Identical sequences A5CPS4
443906.CMM_1034 gi|148272214|ref|YP_001221775.1| WP_012037720.1.11755 WP_012037720.1.31775 WP_012037720.1.56944 WP_012037720.1.64112 WP_012037720.1.75151 WP_012037720.1.80587 WP_012037720.1.84123 WP_012037720.1.88496 WP_012037720.1.97611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]