SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148272348|ref|YP_001221909.1| from Clavibacter michiganensis subsp. michiganensis NCPPB 382

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148272348|ref|YP_001221909.1|
Domain Number 1 Region: 3-295
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.77e-76
Family ATP synthase (F1-ATPase), gamma subunit 0.0000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148272348|ref|YP_001221909.1|
Sequence length 299
Comment F0F1 ATP synthase subunit gamma [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
Sequence
MGAQLRVYTQKIKSAQTTKKITRAMELISASRIQKAQQRMAASAPYSRAVTRAVSAVATF
SNVDHILTTEPEKVERAAIVIFASDRGLAGAFSSSVLKESEQLAELLRSQGKDIVYYLVG
RKAVGYFKFRKRSSERIWTGSTEKPEFETAKSIGDALVEKFVTPASEGGVDEIHIVFNRF
VSIATQKPEVVRLLPLEVVEGVEAPGEGAVLPLYEFEPEVGDVLDALLPVYIESRIFNAM
LQSAASEHAARQKAMKSASDNADKLVTTYTRLRNNARQTEITQQISEIVGGADALASSK
Download sequence
Identical sequences A5CQ59
gi|148272348|ref|YP_001221909.1| WP_012037854.1.31775 WP_012037854.1.56944 WP_012037854.1.64112 WP_012037854.1.75151 WP_012037854.1.80587 WP_012037854.1.8140 WP_012037854.1.84123 WP_012037854.1.88496 443906.CMM_1168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]