SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148272826|ref|YP_001222387.1| from Clavibacter michiganensis subsp. michiganensis NCPPB 382

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148272826|ref|YP_001222387.1|
Domain Number 1 Region: 19-266
Classification Level Classification E-value
Superfamily Cgl1923-like 9.94e-77
Family Cgl1923-like 0.00000575
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148272826|ref|YP_001222387.1|
Sequence length 306
Comment hypothetical protein CMM_1644 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
Sequence
MADADGLYEIDTDIGEVPTGLPLVAGLTGFSDAGSGVSQVSEYLLSTLSHRDVLRFDTDT
LLDYRARRPTIYFDQDHLADYRPARLALYLAHDEIGQPFLLLTGFEPDFRWEAFTAAVLG
IVDRYRVSTTTWVHAIPMPVPHTRDINVTVSGNRTELIDALSVWKPHTQVPANALHLVEH
RLHDAGHPVAGFVLLVPHYLADTEFPLAAVAALESISAATGLIFPTDRLREEGRDFVGRI
DEQVAGNQELARLVTTLEERYDSYMEDTPLKSPLTDEDGALPTADEIAAELEKFLARRRP
GDGDAA
Download sequence
Identical sequences A0A067LTB3 A0A225CJ79 A5CRI7
gi|148272826|ref|YP_001222387.1| WP_012038332.1.11755 WP_012038332.1.31775 WP_012038332.1.36461 WP_012038332.1.56944 WP_012038332.1.64112 WP_012038332.1.75151 WP_012038332.1.80587 WP_012038332.1.8140 WP_012038332.1.84123 WP_012038332.1.88496 WP_012038332.1.97611 WP_012038332.1.97849 443906.CMM_1644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]