SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148273283|ref|YP_001222844.1| from Clavibacter michiganensis subsp. michiganensis NCPPB 382

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148273283|ref|YP_001222844.1|
Domain Number 1 Region: 23-111
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.0000000105
Family Heme-dependent catalases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148273283|ref|YP_001222844.1|
Sequence length 243
Comment hypothetical protein CMM_2099 [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
Sequence
MSGTLARIGGNVLAGLVSAVRLVRQPRPLHPHGVALSGTLTPVAGRAASGLAWLDALDGT
LAVDARFSRGGGLPAALPDVLGLALRIPEEGGTTVDVLLASTGVSPTDRFLLAPRRALSG
ARLTTLMPYRGSAGPVLLGVLVDADPPLPAGADDLGRVLATRPARMRLVHATPRGRWHVA
ARIELTHDADGPLDTATRADPVLAAPPGDTTYPWTRRLRSPGYRVARAGRPVASRHAAQD
PDA
Download sequence
Identical sequences A5CSU4
WP_012038789.1.80587 443906.CMM_2099 gi|148273283|ref|YP_001222844.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]