SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148273729|ref|YP_001223290.1| from Clavibacter michiganensis subsp. michiganensis NCPPB 382

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148273729|ref|YP_001223290.1|
Domain Number 1 Region: 4-191
Classification Level Classification E-value
Superfamily Formyltransferase 1.44e-52
Family Formyltransferase 0.0000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148273729|ref|YP_001223290.1|
Sequence length 199
Comment phosphoribosylglycinamide formyltransferase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
Sequence
MRVLNVVVLISGSGTNLHALLEAADHARYPARVIAVGADRDADGLRFAEERGIPTFTVPF
ASFPDRASWGDELAAAIAGWEPDLVVLSGFMRLLPPRAVAAFAPRIVNTHPAYLPEFPGA
HAVRDAIAAGATSSGASIIVVDTGVDTGPVLAQERVPVEPDDTEHTLHERIKVVERRLLV
DTVRAISLGTIDLKELSPA
Download sequence
Identical sequences A0A1Y3FA43 A5CU41
443906.CMM_2545 WP_012039234.1.100120 WP_012039234.1.11755 WP_012039234.1.31775 WP_012039234.1.36461 WP_012039234.1.56944 WP_012039234.1.64112 WP_012039234.1.75151 WP_012039234.1.80587 WP_012039234.1.8140 WP_012039234.1.84123 WP_012039234.1.88496 WP_012039234.1.97611 gi|148273729|ref|YP_001223290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]