SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148273762|ref|YP_001223323.1| from Clavibacter michiganensis subsp. michiganensis NCPPB 382

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148273762|ref|YP_001223323.1|
Domain Number 1 Region: 3-170
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.77e-39
Family Phosphoglucomutase, first 3 domains 0.00072
Further Details:      
 
Domain Number 2 Region: 247-354
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.03e-29
Family Phosphoglucomutase, first 3 domains 0.0053
Further Details:      
 
Domain Number 3 Region: 147-245
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.49e-25
Family Phosphoglucomutase, first 3 domains 0.0011
Further Details:      
 
Domain Number 4 Region: 347-435
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 7.46e-22
Family Phosphoglucomutase, C-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|148273762|ref|YP_001223323.1|
Sequence length 437
Comment phosphoglucosamine mutase [Clavibacter michiganensis subsp. michiganensis NCPPB 382]
Sequence
MPRLFGTDGVRGLANGETITADLALRLAQAAAHVLGQDARDPRVSGEFIAAAVAAGLASS
GVDVFDAGVIPTPATAYLIADFDADFGVMISASHNPAPDNGIKFFAAGGRKLADELEDRI
EAQLSRPVLLPTGADVGRIRRFADAEDRYVLHLLGTLQHRLDGIHVVLDCAHGAAAGISP
EVFTDAGARVTVIGNDPDGMNINDRVGSTHLDLLAEAVLAHGADVGIAHDGDADRCLAVD
HTGAIIDGDQIMAVLALSMARRGLLAERTLVATVMSNLGLRIAMAENDITVMQTRVGDRY
VLEAMNEGGYSLGGEQSGHLVIAEHATTGDGILTGIQLLGEMAATGKSLHELASVMTVYP
QVMINVRGVDRDRVGDDAELNAAVARAEAELGDTGRILMRASGTEPMIRVMVEAADQATA
ERHAEELAALVTERLAI
Download sequence
Identical sequences A5CU74
443906.CMM_2578 gi|148273762|ref|YP_001223323.1| WP_012039267.1.80587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]